Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013948.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family HD-ZIP
Protein Properties Length: 809aa    MW: 87883.9 Da    PI: 5.2781
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013948.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  ++k +++t++q++eLe++F+++++p++++r eL+++lgL+ +qVk+WFqNrR+++k
                  79999************************************************999 PP

        START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.........dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                  la++a++elvk++++++p+W kss   +++n +e+        +           +ea r++ vv+ ++  lve+l+d + +W e+++    +a+t++
                  6899********************7665555555433......333345678789*************************.***************** PP

        START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkg 174
                   is+g      galqlm+aelq+lsp+vp R   f+R+++q+ +g+w++vdvS+d +q+ p++ ++v +++lpSg+++++++n+ skvtw+eh+++++
                  ************************************************************************************************** PP

        START 175 rlphwllrslvksglaegaktwvatlqrqce 205
                  +++h l+r +++sg+ +ga++w+atlqrq+e
                  *****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.945117177IPR001356Homeobox domain
SMARTSM003891.0E-18119181IPR001356Homeobox domain
CDDcd000865.12E-20120177No hitNo description
PfamPF000463.0E-19120175IPR001356Homeobox domain
PROSITE patternPS000270152175IPR017970Homeobox, conserved site
PROSITE profilePS5084840.947317550IPR002913START domain
SuperFamilySSF559612.42E-30318547No hitNo description
CDDcd088752.25E-108321546No hitNo description
SMARTSM002341.1E-41326547IPR002913START domain
PfamPF018525.3E-50327546IPR002913START domain
Gene3DG3DSA:3.30.530.206.1E-7380530IPR023393START-like domain
SuperFamilySSF559611.1E-21568802No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009371299.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM5X4A00.0M5X4A0_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein